PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo18G0006400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GATA
Protein Properties Length: 324aa    MW: 34371 Da    PI: 5.2498
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo18G0006400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.44e-18215249135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +C t kTp+WR gp g+ktLCnaCG+++++ +l
  Spipo18G0006400 215 CLHCATDKTPQWRAGPMGPKTLCNACGVRFKSGRL 249
                      99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.6E-7416299IPR016679Transcription factor, GATA, plant
SMARTSM004012.4E-17209259IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.78209245IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.13E-15210272No hitNo description
Gene3DG3DSA:3.30.50.102.5E-14212247IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.02E-14214261No hitNo description
PfamPF003205.4E-16215249IPR000679Zinc finger, GATA-type
PROSITE patternPS003440215240IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MEVPESLQGG HRRSGSHQCA VVEKQGRSPG DAFLVEDLLD FSNEEGGLCE GDEVGLEVTP  60
VESTPTAVDS STSSGSEPQF PGELGFSGGG LSDGLSAMYD ELAELEWLSN FVEESFSGDD  120
LHRLLLISGA AAKSSSPASS CGRSELSTEP AAVTLPPEAH VPGKARSKRS RHSSSSTWSS  180
RLLVLSSATS SEDDGEKEEA AIEPDGPNGP DGRRCLHCAT DKTPQWRAGP MGPKTLCNAC  240
GVRFKSGRLV PEYRPAASPT FVPTRHSNSH RKVLELRRQK EADPPPAAAR HLHPCGTYQH  300
PPAAAADDFL IHARVGPDFR QLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010924658.11e-97PREDICTED: GATA transcription factor 12-like
SwissprotO826321e-76GATA9_ARATH; GATA transcription factor 9
TrEMBLM0SJI63e-96M0SJI6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P31720_0017e-96(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30253178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.12e-59GATA transcription factor 9